LL37
$88.00Choose a specification to see its price.
Description
Product Overview
- Full Name: LL37 Cathelicidin Antimicrobial Peptide
- Amino Acid Sequence: [LL-37, 37 aa]
- Molecular Formula:C₂₀₁H₃₅₂N₆₀O₆₄
- Molecular Weight: ~4493.3 g/mol
- CAS Number: 597562-32-8
- Core Mechanism
- Broad-spectrum antibacterial, antifungal and antiviral activity to eliminate pathogens.
- Suppress excessive inflammatory cytokines and repair damaged epithelial barriers.
- Promote skin cell proliferation, accelerate wound healing and tissue regeneration.
- Modulate immune cell activity to enhance local defense against infection.
- Purity: ≥ 99% (Verified , Endotoxin < 1 EU/mg)
Product Attributes
| Attribute | Details |
|---|---|
| Purity | ≥ 99% full batch inspection, endotoxin level below 1 EU/mg |
| Unreconstituted Storage | -20 ± 5°C, sealed, protected from light and moisture, 24-month shelf life |
| Post-Reconstitution Storage | Refrigerate at 2–8°C, finish all liquid within 28 days; freezing is prohibited |
| Appearance | White to off-white lyophilized powder |
What is LL-37?
LL-37 is an investigational research material commonly evaluated in laboratory models involving innate immune signaling, host-defense peptide models, and microbial-response pathway research. For laboratory research use only.
How LL-37 Works
LL-37 is studied as an antimicrobial peptide research material in controlled laboratory workflows. It is commonly used in models involving innate immune signaling, host-defense peptide models, and microbial-response pathway research.
Research interest in LL-37 comes from its ability to help evaluate pathway behavior, receptor or target response, formulation stability, and analytical performance under controlled laboratory conditions. Results depend on model design, material handling, and validated research protocols.
Storage
Product documentation
Specifications have not been published.
Batch reports
No public batches have been published for this product.
Additional information
| Specifications | 5mg*10 vials |
|---|
Related products
-
HCG
Current price: $38.000 published batchesView details -
Retatrutide
Current price: $86.30Regular price: $102.0015% off0 published batchesView details -
Glutathione
Current price: $32.000 published batchesView details -
Hexarelin Acetate
Current price: $42.000 published batchesView details
Reviews
There are no reviews yet.